Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  7. Avatar for Team China 18. Team China 1 pt. 9,048
  8. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  9. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696

  1. Avatar for malphis 11. malphis Lv 1 78 pts. 10,991
  2. Avatar for silent gene 12. silent gene Lv 1 76 pts. 10,972
  3. Avatar for grogar7 13. grogar7 Lv 1 74 pts. 10,966
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 72 pts. 10,958
  5. Avatar for Galaxie 15. Galaxie Lv 1 70 pts. 10,954
  6. Avatar for spmm 16. spmm Lv 1 68 pts. 10,946
  7. Avatar for Deleted player 17. Deleted player 67 pts. 10,946
  8. Avatar for Susume 18. Susume Lv 1 65 pts. 10,943
  9. Avatar for RockOn 19. RockOn Lv 1 63 pts. 10,926
  10. Avatar for LastAndroid 20. LastAndroid Lv 1 62 pts. 10,913

Comments