Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for 01010011111 191. 01010011111 Lv 1 1 pt. 8,335
  2. Avatar for Maimuna_A 192. Maimuna_A Lv 1 1 pt. 8,106
  3. Avatar for YellowBearPL 193. YellowBearPL Lv 1 1 pt. 7,114
  4. Avatar for uihcv 194. uihcv Lv 1 1 pt. 6,492
  5. Avatar for corvidcapsule 195. corvidcapsule Lv 1 1 pt. 6,151
  6. Avatar for mwm64 196. mwm64 Lv 1 1 pt. 6,022
  7. Avatar for LindaHwang 197. LindaHwang Lv 1 1 pt. 1,572
  8. Avatar for Corruption 198. Corruption Lv 1 1 pt. 0
  9. Avatar for Rosa Palomino Torres 199. Rosa Palomino Torres Lv 1 1 pt. 0
  10. Avatar for HuubR 200. HuubR Lv 1 1 pt. 0

Comments