Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for actiasluna 41. actiasluna Lv 1 34 pts. 10,719
  2. Avatar for georg137 42. georg137 Lv 1 33 pts. 10,707
  3. Avatar for GuR0 43. GuR0 Lv 1 32 pts. 10,704
  4. Avatar for guineapig 44. guineapig Lv 1 31 pts. 10,695
  5. Avatar for diamonddays 45. diamonddays Lv 1 30 pts. 10,686
  6. Avatar for Deleted player 46. Deleted player pts. 10,685
  7. Avatar for argyrw 47. argyrw Lv 1 28 pts. 10,675
  8. Avatar for aznarog 48. aznarog Lv 1 27 pts. 10,668
  9. Avatar for O Seki To 49. O Seki To Lv 1 26 pts. 10,659
  10. Avatar for ichwilldiesennamen 50. ichwilldiesennamen Lv 1 25 pts. 10,648

Comments