Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 10,601
  2. Avatar for Marvin's bunch 12. Marvin's bunch 3 pts. 10,425
  3. Avatar for Russian team 13. Russian team 2 pts. 10,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,190
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 10,119
  6. Avatar for Kangwon_National_University_Computers_in_Chemistry 16. Kangwon_National_University_Computers_in_Chemistry 1 pt. 9,362
  7. Avatar for GBHS BMAH kids 17. GBHS BMAH kids 1 pt. 9,248
  8. Avatar for Team China 18. Team China 1 pt. 9,048
  9. Avatar for Trinity Biology 19. Trinity Biology 1 pt. 8,907
  10. Avatar for CHNO Junkies 20. CHNO Junkies 1 pt. 8,696
  1. Avatar for actiasluna 41. actiasluna Lv 1 34 pts. 10,719
  2. Avatar for georg137 42. georg137 Lv 1 33 pts. 10,707
  3. Avatar for GuR0 43. GuR0 Lv 1 32 pts. 10,704
  4. Avatar for guineapig 44. guineapig Lv 1 31 pts. 10,695
  5. Avatar for diamonddays 45. diamonddays Lv 1 30 pts. 10,686
  6. Avatar for Deleted player 46. Deleted player pts. 10,685
  7. Avatar for argyrw 47. argyrw Lv 1 28 pts. 10,675
  8. Avatar for aznarog 48. aznarog Lv 1 27 pts. 10,668
  9. Avatar for O Seki To 49. O Seki To Lv 1 26 pts. 10,659
  10. Avatar for ichwilldiesennamen 50. ichwilldiesennamen Lv 1 25 pts. 10,648

Comments