Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,106
  2. Avatar for Biochemistry-I-CSolisC 1 22. Biochemistry-I-CSolisC 1 1 pt. 0
  1. Avatar for Xartos
    1. Xartos Lv 1
    100 pts. 11,177
  2. Avatar for Phyx 2. Phyx Lv 1 98 pts. 11,172
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 11,121
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 93 pts. 11,077
  5. Avatar for johnmitch 5. johnmitch Lv 1 91 pts. 11,056
  6. Avatar for g_b 6. g_b Lv 1 89 pts. 11,028
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 87 pts. 11,024
  8. Avatar for drjr 8. drjr Lv 1 84 pts. 11,006
  9. Avatar for Aubade01 9. Aubade01 Lv 1 82 pts. 11,005
  10. Avatar for KarenCH 10. KarenCH Lv 1 80 pts. 11,002

Comments