Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups



  1. Avatar for Xartos
    1. Xartos Lv 1
    100 pts. 11,177
  2. Avatar for Phyx 2. Phyx Lv 1 98 pts. 11,172
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 11,121
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 93 pts. 11,077
  5. Avatar for johnmitch 5. johnmitch Lv 1 91 pts. 11,056
  6. Avatar for g_b 6. g_b Lv 1 89 pts. 11,028
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 87 pts. 11,024
  8. Avatar for drjr 8. drjr Lv 1 84 pts. 11,006
  9. Avatar for Aubade01 9. Aubade01 Lv 1 82 pts. 11,005
  10. Avatar for KarenCH 10. KarenCH Lv 1 80 pts. 11,002

Comments