Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,106
  2. Avatar for Biochemistry-I-CSolisC 1 22. Biochemistry-I-CSolisC 1 1 pt. 0
  1. Avatar for joshmiller
    1. joshmiller Lv 1
    100 pts. 11,569
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 85 pts. 11,201
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 72 pts. 11,200
  4. Avatar for Dhalion 4. Dhalion Lv 1 61 pts. 11,199
  5. Avatar for Xartos 5. Xartos Lv 1 51 pts. 11,198
  6. Avatar for Czim 6. Czim Lv 1 42 pts. 11,197
  7. Avatar for mirp 7. mirp Lv 1 35 pts. 11,195
  8. Avatar for Phyx 8. Phyx Lv 1 28 pts. 11,195
  9. Avatar for pente_player 9. pente_player Lv 1 23 pts. 11,188
  10. Avatar for puxatudo 10. puxatudo Lv 1 19 pts. 11,140

Comments