Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,106
  2. Avatar for Biochemistry-I-CSolisC 1 22. Biochemistry-I-CSolisC 1 1 pt. 0
  1. Avatar for joshmiller
    1. joshmiller Lv 1
    100 pts. 11,569
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 85 pts. 11,201
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 72 pts. 11,200
  4. Avatar for Dhalion 4. Dhalion Lv 1 61 pts. 11,199
  5. Avatar for Xartos 5. Xartos Lv 1 51 pts. 11,198
  6. Avatar for Czim 6. Czim Lv 1 42 pts. 11,197
  7. Avatar for mirp 7. mirp Lv 1 35 pts. 11,195
  8. Avatar for Phyx 8. Phyx Lv 1 28 pts. 11,195
  9. Avatar for pente_player 9. pente_player Lv 1 23 pts. 11,188
  10. Avatar for puxatudo 10. puxatudo Lv 1 19 pts. 11,140

Comments