Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for wudoo 121. wudoo Lv 1 2 pts. 9,658
  2. Avatar for RW-QuantumSec 122. RW-QuantumSec Lv 1 2 pts. 9,639
  3. Avatar for Crossed Sticks 123. Crossed Sticks Lv 1 1 pt. 9,636
  4. Avatar for aniri 124. aniri Lv 1 1 pt. 9,624
  5. Avatar for drumpeter18yrs9yrs 125. drumpeter18yrs9yrs Lv 1 1 pt. 9,617
  6. Avatar for xbp 126. xbp Lv 1 1 pt. 9,578
  7. Avatar for fishercat 127. fishercat Lv 1 1 pt. 9,577
  8. Avatar for Evica 128. Evica Lv 1 1 pt. 9,575
  9. Avatar for Superphosphate 129. Superphosphate Lv 1 1 pt. 9,555
  10. Avatar for Ann2001 130. Ann2001 Lv 1 1 pt. 9,547

Comments