Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for nspc 131. nspc Lv 1 1 pt. 9,533
  2. Avatar for jtrube1 132. jtrube1 Lv 1 1 pt. 9,526
  3. Avatar for CAN1958 133. CAN1958 Lv 1 1 pt. 9,525
  4. Avatar for zeluis 134. zeluis Lv 1 1 pt. 9,505
  5. Avatar for rinze 135. rinze Lv 1 1 pt. 9,468
  6. Avatar for peatw 136. peatw Lv 1 1 pt. 9,452
  7. Avatar for parsnip 137. parsnip Lv 1 1 pt. 9,432
  8. Avatar for Sadaharu06.jp 138. Sadaharu06.jp Lv 1 1 pt. 9,431
  9. Avatar for sciencewalker 139. sciencewalker Lv 1 1 pt. 9,426
  10. Avatar for dahast.de 140. dahast.de Lv 1 1 pt. 9,426

Comments