Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for Trajan464 141. Trajan464 Lv 1 1 pt. 9,423
  2. Avatar for frostschutz 142. frostschutz Lv 1 1 pt. 9,421
  3. Avatar for Dolichwier 143. Dolichwier Lv 1 1 pt. 9,417
  4. Avatar for KingoRodriguo 144. KingoRodriguo Lv 1 1 pt. 9,416
  5. Avatar for Pibeagles1 145. Pibeagles1 Lv 1 1 pt. 9,414
  6. Avatar for devjosh 146. devjosh Lv 1 1 pt. 9,394
  7. Avatar for tzugypsyl 147. tzugypsyl Lv 1 1 pt. 9,384
  8. Avatar for Mikisp 148. Mikisp Lv 1 1 pt. 9,382
  9. Avatar for 201713434 149. 201713434 Lv 1 1 pt. 9,362
  10. Avatar for dldahlen 150. dldahlen Lv 1 1 pt. 9,340

Comments