Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for 01010011111 191. 01010011111 Lv 1 1 pt. 8,335
  2. Avatar for Maimuna_A 192. Maimuna_A Lv 1 1 pt. 8,106
  3. Avatar for YellowBearPL 193. YellowBearPL Lv 1 1 pt. 7,114
  4. Avatar for uihcv 194. uihcv Lv 1 1 pt. 6,492
  5. Avatar for corvidcapsule 195. corvidcapsule Lv 1 1 pt. 6,151
  6. Avatar for mwm64 196. mwm64 Lv 1 1 pt. 6,022
  7. Avatar for LindaHwang 197. LindaHwang Lv 1 1 pt. 1,572
  8. Avatar for Domnom_09 198. Domnom_09 Lv 1 1 pt. 0
  9. Avatar for puxatudo 199. puxatudo Lv 1 1 pt. 0

Comments