Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since almost 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for inhtih 51. inhtih Lv 1 25 pts. 10,647
  2. Avatar for Tygh 52. Tygh Lv 1 24 pts. 10,646
  3. Avatar for Todd6485577 53. Todd6485577 Lv 1 23 pts. 10,617
  4. Avatar for Hiro Protagonist 54. Hiro Protagonist Lv 1 22 pts. 10,610
  5. Avatar for pmthomson90 55. pmthomson90 Lv 1 22 pts. 10,601
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 21 pts. 10,575
  7. Avatar for MicElephant 57. MicElephant Lv 1 20 pts. 10,564
  8. Avatar for ManVsYard 58. ManVsYard Lv 1 20 pts. 10,525
  9. Avatar for BarrySampson 59. BarrySampson Lv 1 19 pts. 10,524
  10. Avatar for Lotus23 60. Lotus23 Lv 1 18 pts. 10,506

Comments