Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for Vinara 31. Vinara Lv 1 45 pts. 10,830
  2. Avatar for Pazithi 32. Pazithi Lv 1 44 pts. 10,796
  3. Avatar for TastyMunchies 33. TastyMunchies Lv 1 43 pts. 10,792
  4. Avatar for Deleted player 34. Deleted player pts. 10,792
  5. Avatar for BootsMcGraw 35. BootsMcGraw Lv 1 40 pts. 10,791
  6. Avatar for nicobul 36. nicobul Lv 1 39 pts. 10,771
  7. Avatar for phi16 37. phi16 Lv 1 38 pts. 10,759
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 37 pts. 10,748
  9. Avatar for Alistair69 39. Alistair69 Lv 1 36 pts. 10,744
  10. Avatar for OWM3 40. OWM3 Lv 1 35 pts. 10,720

Comments