Placeholder image of a protein
Icon representing a puzzle

1860: Refinement Puzzle: R1040

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
July 03, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!



Sequence:


PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 10,886
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 10,876
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,496
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,455
  5. Avatar for Australia 15. Australia 1 pt. 10,378
  6. Avatar for GBHS BMAH kids 16. GBHS BMAH kids 1 pt. 10,275
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,173
  8. Avatar for Team Canada 18. Team Canada 1 pt. 8,820
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,822
  10. Avatar for incognito group 20. incognito group 1 pt. 7,235
  1. Avatar for Mike Cassidy 101. Mike Cassidy Lv 1 3 pts. 10,752
  2. Avatar for Jakki 102. Jakki Lv 1 2 pts. 10,729
  3. Avatar for alcor29 103. alcor29 Lv 1 2 pts. 10,724
  4. Avatar for pandapharmd 104. pandapharmd Lv 1 2 pts. 10,700
  5. Avatar for Kevonni 105. Kevonni Lv 1 2 pts. 10,674
  6. Avatar for Jpilkington 106. Jpilkington Lv 1 2 pts. 10,666
  7. Avatar for Beany 107. Beany Lv 1 2 pts. 10,664
  8. Avatar for felixxy 108. felixxy Lv 1 2 pts. 10,641
  9. Avatar for knotartist 109. knotartist Lv 1 2 pts. 10,634
  10. Avatar for AlkiP0Ps 110. AlkiP0Ps Lv 1 2 pts. 10,632

Comments

beta_helix Staff Lv 1

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!