Placeholder image of a protein
Icon representing a puzzle

1860: Refinement Puzzle: R1040

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
July 03, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!



Sequence:


PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 10,886
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 10,876
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,496
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 10,455
  5. Avatar for Australia 15. Australia 1 pt. 10,378
  6. Avatar for GBHS BMAH kids 16. GBHS BMAH kids 1 pt. 10,275
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,173
  8. Avatar for Team Canada 18. Team Canada 1 pt. 8,820
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,822
  10. Avatar for incognito group 20. incognito group 1 pt. 7,235
  1. Avatar for SKSbell 111. SKSbell Lv 1 2 pts. 10,631
  2. Avatar for Arne Heessels 112. Arne Heessels Lv 1 2 pts. 10,627
  3. Avatar for sitlux 113. sitlux Lv 1 1 pt. 10,615
  4. Avatar for Dr.Sillem 114. Dr.Sillem Lv 1 1 pt. 10,606
  5. Avatar for Czim 115. Czim Lv 1 1 pt. 10,605
  6. Avatar for fiendish_ghoul 116. fiendish_ghoul Lv 1 1 pt. 10,605
  7. Avatar for SEF830 117. SEF830 Lv 1 1 pt. 10,600
  8. Avatar for BarrySampson 118. BarrySampson Lv 1 1 pt. 10,579
  9. Avatar for xabxs 119. xabxs Lv 1 1 pt. 10,566
  10. Avatar for ShadowTactics 120. ShadowTactics Lv 1 1 pt. 10,563

Comments

beta_helix Staff Lv 1

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!