Placeholder image of a protein
Icon representing a puzzle

1860: Refinement Puzzle: R1040

Closed since almost 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 03, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!



Sequence:


PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI

Top groups


  1. Avatar for Go Science 100 pts. 11,868
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,852
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 58 pts. 11,767
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 11,729
  5. Avatar for Contenders 5. Contenders 31 pts. 11,676
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,633
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 11,316
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 11,297
  9. Avatar for Russian team 9. Russian team 7 pts. 11,169
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 11,004

  1. Avatar for LociOiling 11. LociOiling Lv 1 11 pts. 11,851
  2. Avatar for Czim 12. Czim Lv 1 9 pts. 11,832
  3. Avatar for donuts554 13. donuts554 Lv 1 7 pts. 11,813
  4. Avatar for Phyx 14. Phyx Lv 1 5 pts. 11,813
  5. Avatar for Galaxie 15. Galaxie Lv 1 4 pts. 11,729
  6. Avatar for alcor29 16. alcor29 Lv 1 3 pts. 11,711
  7. Avatar for robgee 17. robgee Lv 1 2 pts. 11,706
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 1 pt. 11,676
  9. Avatar for OWM3 19. OWM3 Lv 1 1 pt. 11,633
  10. Avatar for LastAndroid 20. LastAndroid Lv 1 1 pt. 11,611

Comments


beta_helix Staff Lv 1

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!