Placeholder image of a protein
Icon representing a puzzle

1860: Refinement Puzzle: R1040

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
July 03, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!



Sequence:


PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI

Top groups


  1. Avatar for Go Science 100 pts. 11,868
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,852
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 58 pts. 11,767
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 11,729
  5. Avatar for Contenders 5. Contenders 31 pts. 11,676
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,633
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 11,316
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 11,297
  9. Avatar for Russian team 9. Russian team 7 pts. 11,169
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 11,004

  1. Avatar for tangofox10 81. tangofox10 Lv 1 7 pts. 11,018
  2. Avatar for infjamc 82. infjamc Lv 1 6 pts. 11,006
  3. Avatar for fpc 83. fpc Lv 1 6 pts. 11,004
  4. Avatar for Dhalion 84. Dhalion Lv 1 6 pts. 11,002
  5. Avatar for ZeroLeak7 85. ZeroLeak7 Lv 1 5 pts. 10,990
  6. Avatar for FractalCuber 86. FractalCuber Lv 1 5 pts. 10,953
  7. Avatar for lconor 87. lconor Lv 1 5 pts. 10,942
  8. Avatar for sgeldhof 88. sgeldhof Lv 1 5 pts. 10,936
  9. Avatar for jsfoldingaccount 89. jsfoldingaccount Lv 1 5 pts. 10,918
  10. Avatar for xxx10g 90. xxx10g Lv 1 4 pts. 10,897

Comments


beta_helix Staff Lv 1

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!