Placeholder image of a protein
Icon representing a puzzle

1860: Refinement Puzzle: R1040

Closed since over 5 years ago

Intermediate Overall Prediction

Summary

Created
July 03, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures.
CASP14 has released this refinement target, but this time with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds could be far from both starts!



Sequence:


PNFKVEHTKKSFKLAKDYIAQNEITVEEMYDELEDHGFNIDDIANGEEVTESAITEAFIKNHILNSNSELEYHNDFVKQHNIDAVNKIDFLGYSEELHKNKSEQLQNRLFDLYWAVLTNEKTYGDLITPI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,868
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,852
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 58 pts. 11,767
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 11,729
  5. Avatar for Contenders 5. Contenders 31 pts. 11,676
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 11,633
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 11,316
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 11,297
  9. Avatar for Russian team 9. Russian team 7 pts. 11,169
  10. Avatar for Marvin's bunch 10. Marvin's bunch 5 pts. 11,004
  1. Avatar for phi16 21. phi16 Lv 1 57 pts. 11,494
  2. Avatar for OWM3 22. OWM3 Lv 1 55 pts. 11,491
  3. Avatar for guineapig 23. guineapig Lv 1 54 pts. 11,490
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 52 pts. 11,483
  5. Avatar for RockOn 25. RockOn Lv 1 51 pts. 11,474
  6. Avatar for Skippysk8s 26. Skippysk8s Lv 1 49 pts. 11,460
  7. Avatar for malphis 27. malphis Lv 1 48 pts. 11,448
  8. Avatar for LastAndroid 28. LastAndroid Lv 1 46 pts. 11,442
  9. Avatar for Deleted player 29. Deleted player pts. 11,441
  10. Avatar for Bletchley Park 30. Bletchley Park Lv 1 43 pts. 11,427

Comments

beta_helix Staff Lv 1

Just note that the servers that produced these CASP predictions also used PSIPRED (and more), yet ended up with these incorrect solutions.

While I doubt the native has the exact opposite of these PSIPRED predictions, it is very unlikely that it follows them perfectly!