Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402
  1. Avatar for Xartos
    1. Xartos Lv 1
    100 pts. 12,057
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 98 pts. 12,032
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 95 pts. 11,963
  4. Avatar for Galaxie 4. Galaxie Lv 1 92 pts. 11,938
  5. Avatar for Serca 5. Serca Lv 1 90 pts. 11,868
  6. Avatar for Phyx 6. Phyx Lv 1 87 pts. 11,866
  7. Avatar for malphis 7. malphis Lv 1 85 pts. 11,857
  8. Avatar for LociOiling 8. LociOiling Lv 1 82 pts. 11,846
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 80 pts. 11,815
  10. Avatar for OWM3 10. OWM3 Lv 1 78 pts. 11,804

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.