Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 10,871
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,782
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,723
  4. Avatar for Deleted group 14. Deleted group pts. 10,709
  5. Avatar for GBHS BMAH kids 15. GBHS BMAH kids 1 pt. 10,648
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 10,640
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 10,402
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 12,073
  2. Avatar for mirp 2. mirp Lv 1 83 pts. 12,072
  3. Avatar for Xartos 3. Xartos Lv 1 69 pts. 12,071
  4. Avatar for silent gene 4. silent gene Lv 1 56 pts. 12,070
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 45 pts. 12,070
  6. Avatar for Czim 6. Czim Lv 1 36 pts. 12,070
  7. Avatar for Dhalion 7. Dhalion Lv 1 29 pts. 12,069
  8. Avatar for puxatudo 8. puxatudo Lv 1 23 pts. 12,027
  9. Avatar for Galaxie 9. Galaxie Lv 1 18 pts. 11,913
  10. Avatar for phi16 10. phi16 Lv 1 14 pts. 11,878

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.