Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups


  1. Avatar for Go Science 100 pts. 12,073
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,938
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 11,870
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,846
  5. Avatar for Contenders 5. Contenders 24 pts. 11,815
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,724
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,640
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,632
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,451
  10. Avatar for Russian team 10. Russian team 2 pts. 11,233

  1. Avatar for jausmh 31. jausmh Lv 1 40 pts. 11,558
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 39 pts. 11,542
  3. Avatar for johnmitch 33. johnmitch Lv 1 38 pts. 11,537
  4. Avatar for Jpilkington 34. Jpilkington Lv 1 36 pts. 11,530
  5. Avatar for Merf 35. Merf Lv 1 35 pts. 11,513
  6. Avatar for robgee 36. robgee Lv 1 34 pts. 11,484
  7. Avatar for grogar7 37. grogar7 Lv 1 33 pts. 11,476
  8. Avatar for aznarog 38. aznarog Lv 1 32 pts. 11,475
  9. Avatar for spmm 39. spmm Lv 1 31 pts. 11,451
  10. Avatar for Vinara 40. Vinara Lv 1 30 pts. 11,449

Comments


LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.