Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,073
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,938
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 11,870
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,846
  5. Avatar for Contenders 5. Contenders 24 pts. 11,815
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,724
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,640
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,632
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,451
  10. Avatar for Russian team 10. Russian team 2 pts. 11,233
  1. Avatar for mirp 11. mirp Lv 1 75 pts. 11,795
  2. Avatar for Pazithi 12. Pazithi Lv 1 73 pts. 11,794
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 71 pts. 11,783
  4. Avatar for pauldunn 14. pauldunn Lv 1 69 pts. 11,775
  5. Avatar for drjr 15. drjr Lv 1 67 pts. 11,769
  6. Avatar for Deleted player 16. Deleted player pts. 11,728
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 63 pts. 11,724
  8. Avatar for MicElephant 18. MicElephant Lv 1 61 pts. 11,715
  9. Avatar for phi16 19. phi16 Lv 1 59 pts. 11,713
  10. Avatar for TastyMunchies 20. TastyMunchies Lv 1 57 pts. 11,689

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.