Placeholder image of a protein
Icon representing a puzzle

1863: Refinement Puzzle: R1043

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 09, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


SFEEQFIKNNSDSNILAPKVSQSVIKSIKGIKSKHVFELPINDKTKRYILGATETKEEVLPNYVKVGSDLYRLKAYREKSGVYVRTNKLGFEDPKSFLSIKEYKFGTRTGGNFTGELTKQELVYTNQWVNENITLANGYISADSRTVD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,073
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,938
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 11,870
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,846
  5. Avatar for Contenders 5. Contenders 24 pts. 11,815
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,724
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,640
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,632
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,451
  10. Avatar for Russian team 10. Russian team 2 pts. 11,233
  1. Avatar for Evica 61. Evica Lv 1 13 pts. 11,127
  2. Avatar for knotartist 62. knotartist Lv 1 13 pts. 11,118
  3. Avatar for KarenCH 63. KarenCH Lv 1 12 pts. 11,115
  4. Avatar for Pawel Tluscik 64. Pawel Tluscik Lv 1 12 pts. 11,103
  5. Avatar for pfirth 65. pfirth Lv 1 11 pts. 11,102
  6. Avatar for sitlux 66. sitlux Lv 1 11 pts. 11,101
  7. Avatar for RockOn 67. RockOn Lv 1 10 pts. 11,097
  8. Avatar for nicobul 68. nicobul Lv 1 10 pts. 11,078
  9. Avatar for lynnai 69. lynnai Lv 1 10 pts. 11,059
  10. Avatar for jsfoldingaccount 70. jsfoldingaccount Lv 1 9 pts. 11,048

Comments

LociOiling Lv 1

Seeing a lot of crashes using remix on devprev. Rebuild doesn't seem quite as touchy, but I did get a rebuild crash.

Lots of debug.txts getting generated. Most seem to have a double stack trace, but there's no usable information I can see.