Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,477
  2. Avatar for malphis 2. malphis Lv 1 98 pts. 11,388
  3. Avatar for Aubade01 3. Aubade01 Lv 1 95 pts. 11,342
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 92 pts. 11,314
  5. Avatar for Phyx 5. Phyx Lv 1 89 pts. 11,266
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 86 pts. 11,222
  7. Avatar for mirp 7. mirp Lv 1 84 pts. 11,206
  8. Avatar for KarenCH 8. KarenCH Lv 1 81 pts. 11,205
  9. Avatar for MicElephant 9. MicElephant Lv 1 79 pts. 11,201
  10. Avatar for Galaxie 10. Galaxie Lv 1 76 pts. 11,186

Comments