Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,477
  2. Avatar for malphis 2. malphis Lv 1 98 pts. 11,388
  3. Avatar for Aubade01 3. Aubade01 Lv 1 95 pts. 11,342
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 92 pts. 11,314
  5. Avatar for Phyx 5. Phyx Lv 1 89 pts. 11,266
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 86 pts. 11,222
  7. Avatar for mirp 7. mirp Lv 1 84 pts. 11,206
  8. Avatar for KarenCH 8. KarenCH Lv 1 81 pts. 11,205
  9. Avatar for MicElephant 9. MicElephant Lv 1 79 pts. 11,201
  10. Avatar for Galaxie 10. Galaxie Lv 1 76 pts. 11,186

Comments