Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 3 pts. 9,803
  2. Avatar for SETI.Germany 12. SETI.Germany 2 pts. 9,778
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,398
  4. Avatar for Australia 14. Australia 1 pt. 9,378
  5. Avatar for Team Canada 15. Team Canada 1 pt. 9,298
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 8,973
  7. Avatar for Deleted group 17. Deleted group pts. 8,818
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 8,793
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 8,441
  10. Avatar for Deleted group 20. Deleted group pts. 7,953

  1. Avatar for Deleted player 100 pts. 11,470
  2. Avatar for LociOiling 2. LociOiling Lv 1 81 pts. 11,459
  3. Avatar for Franco Padelletti 3. Franco Padelletti Lv 1 64 pts. 11,393
  4. Avatar for mirp 4. mirp Lv 1 50 pts. 11,390
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 39 pts. 11,390
  6. Avatar for silent gene 6. silent gene Lv 1 30 pts. 11,388
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 23 pts. 11,379
  8. Avatar for Xartos 8. Xartos Lv 1 17 pts. 11,379
  9. Avatar for Galaxie 9. Galaxie Lv 1 12 pts. 11,303
  10. Avatar for Phyx 10. Phyx Lv 1 9 pts. 11,268

Comments