Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for Beta Folders 100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323

  1. Avatar for Deleted player 100 pts. 11,470
  2. Avatar for LociOiling 2. LociOiling Lv 1 81 pts. 11,459
  3. Avatar for Franco Padelletti 3. Franco Padelletti Lv 1 64 pts. 11,393
  4. Avatar for mirp 4. mirp Lv 1 50 pts. 11,390
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 39 pts. 11,390
  6. Avatar for silent gene 6. silent gene Lv 1 30 pts. 11,388
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 23 pts. 11,379
  8. Avatar for Xartos 8. Xartos Lv 1 17 pts. 11,379
  9. Avatar for Galaxie 9. Galaxie Lv 1 12 pts. 11,303
  10. Avatar for Phyx 10. Phyx Lv 1 9 pts. 11,268

Comments