Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for puxatudo 11. puxatudo Lv 1 6 pts. 11,248
  2. Avatar for donuts554 12. donuts554 Lv 1 4 pts. 11,247
  3. Avatar for alwen 13. alwen Lv 1 3 pts. 11,245
  4. Avatar for phi16 14. phi16 Lv 1 2 pts. 11,217
  5. Avatar for KarenCH 15. KarenCH Lv 1 1 pt. 11,204
  6. Avatar for alcor29 16. alcor29 Lv 1 1 pt. 11,188
  7. Avatar for fpc 17. fpc Lv 1 1 pt. 11,132
  8. Avatar for Deleted player 18. Deleted player pts. 10,994
  9. Avatar for Steven Pletsch 19. Steven Pletsch Lv 1 1 pt. 10,821
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 10,560

Comments