Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for Phyx
    1. Phyx Lv 1
    100 pts. 12,035
  2. Avatar for malphis 2. malphis Lv 1 97 pts. 11,987
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 95 pts. 11,981
  4. Avatar for Galaxie 4. Galaxie Lv 1 92 pts. 11,903
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 89 pts. 11,897
  6. Avatar for jobo0502 6. jobo0502 Lv 1 86 pts. 11,857
  7. Avatar for Deleted player 7. Deleted player 83 pts. 11,850
  8. Avatar for LociOiling 8. LociOiling Lv 1 81 pts. 11,843
  9. Avatar for Xartos 9. Xartos Lv 1 78 pts. 11,837
  10. Avatar for pauldunn 10. pauldunn Lv 1 76 pts. 11,821

Comments