Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for Go Science 100 pts. 12,035
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,920
  3. Avatar for Contenders 3. Contenders 49 pts. 11,897
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,857
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 11,850
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,813
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,778
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,733
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 11,611
  10. Avatar for Russian team 10. Russian team 2 pts. 11,474

  1. Avatar for Galaxie 11. Galaxie Lv 1 16 pts. 11,920
  2. Avatar for phi16 12. phi16 Lv 1 13 pts. 11,909
  3. Avatar for alcor29 13. alcor29 Lv 1 10 pts. 11,853
  4. Avatar for LociOiling 14. LociOiling Lv 1 8 pts. 11,840
  5. Avatar for Deleted player 15. Deleted player 6 pts. 11,831
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 5 pts. 11,829
  7. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 3 pts. 11,820
  8. Avatar for pauldunn 19. pauldunn Lv 1 2 pts. 11,807
  9. Avatar for equilibria 20. equilibria Lv 1 2 pts. 11,802

Comments