Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for Go Science 100 pts. 12,035
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,920
  3. Avatar for Contenders 3. Contenders 49 pts. 11,897
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,857
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 11,850
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,813
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,778
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,733
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 11,611
  10. Avatar for Russian team 10. Russian team 2 pts. 11,474

  1. Avatar for HuubR 21. HuubR Lv 1 1 pt. 11,762
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 1 pt. 11,730
  3. Avatar for fpc 23. fpc Lv 1 1 pt. 11,722
  4. Avatar for OWM3 24. OWM3 Lv 1 1 pt. 11,714
  5. Avatar for fisherlr777 25. fisherlr777 Lv 1 1 pt. 11,709
  6. Avatar for Jpilkington 26. Jpilkington Lv 1 1 pt. 11,697
  7. Avatar for Pazithi 27. Pazithi Lv 1 1 pt. 11,688
  8. Avatar for nicobul 28. nicobul Lv 1 1 pt. 11,663
  9. Avatar for Alistair69 29. Alistair69 Lv 1 1 pt. 11,660
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 1 pt. 11,658

Comments