Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477
  1. Avatar for Deleted player
    1. Deleted player
    pts. 12,642
  2. Avatar for Steven Pletsch 2. Steven Pletsch Lv 1 97 pts. 12,604
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 12,559
  4. Avatar for malphis 4. malphis Lv 1 91 pts. 12,516
  5. Avatar for Phyx 5. Phyx Lv 1 88 pts. 12,453
  6. Avatar for Aubade01 6. Aubade01 Lv 1 86 pts. 12,447
  7. Avatar for silent gene 7. silent gene Lv 1 83 pts. 12,440
  8. Avatar for guineapig 8. guineapig Lv 1 80 pts. 12,435
  9. Avatar for Galaxie 9. Galaxie Lv 1 77 pts. 12,434
  10. Avatar for MicElephant 10. MicElephant Lv 1 75 pts. 12,432

Comments