Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,653
  2. Avatar for phi16 2. phi16 Lv 1 84 pts. 12,644
  3. Avatar for robgee 3. robgee Lv 1 70 pts. 12,640
  4. Avatar for Deleted player 4. Deleted player pts. 12,606
  5. Avatar for LociOiling 5. LociOiling Lv 1 48 pts. 12,549
  6. Avatar for Deleted player 6. Deleted player 39 pts. 12,541
  7. Avatar for alcor29 7. alcor29 Lv 1 32 pts. 12,500
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 26 pts. 12,465
  9. Avatar for mirp 9. mirp Lv 1 20 pts. 12,458
  10. Avatar for Dhalion 10. Dhalion Lv 1 16 pts. 12,456

Comments