Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for Xartos 11. Xartos Lv 1 13 pts. 12,453
  2. Avatar for Czim 12. Czim Lv 1 10 pts. 12,452
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 7 pts. 12,452
  4. Avatar for silent gene 14. silent gene Lv 1 6 pts. 12,450
  5. Avatar for puxatudo 15. puxatudo Lv 1 4 pts. 12,399
  6. Avatar for alwen 16. alwen Lv 1 3 pts. 12,363
  7. Avatar for HuubR 17. HuubR Lv 1 2 pts. 12,335
  8. Avatar for Formula350 18. Formula350 Lv 1 2 pts. 12,328
  9. Avatar for Keresto 19. Keresto Lv 1 1 pt. 12,327
  10. Avatar for Mike Lewis 20. Mike Lewis Lv 1 1 pt. 12,325

Comments