Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for Deleted player pts. 12,642
  2. Avatar for Steven Pletsch 2. Steven Pletsch Lv 1 97 pts. 12,604
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 12,559
  4. Avatar for malphis 4. malphis Lv 1 91 pts. 12,516
  5. Avatar for Phyx 5. Phyx Lv 1 88 pts. 12,453
  6. Avatar for Aubade01 6. Aubade01 Lv 1 86 pts. 12,447
  7. Avatar for silent gene 7. silent gene Lv 1 83 pts. 12,440
  8. Avatar for guineapig 8. guineapig Lv 1 80 pts. 12,435
  9. Avatar for Galaxie 9. Galaxie Lv 1 77 pts. 12,434
  10. Avatar for MicElephant 10. MicElephant Lv 1 75 pts. 12,432

Comments