Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for tracybutt 81. tracybutt Lv 1 3 pts. 10,160
  2. Avatar for Anfinsen_slept_here 82. Anfinsen_slept_here Lv 1 3 pts. 10,148
  3. Avatar for pascal ochem 83. pascal ochem Lv 1 3 pts. 10,119
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 3 pts. 10,099
  5. Avatar for dldahlen 85. dldahlen Lv 1 3 pts. 10,074
  6. Avatar for Rav3n_pl 86. Rav3n_pl Lv 1 3 pts. 10,039
  7. Avatar for christioanchauvin 87. christioanchauvin Lv 1 2 pts. 10,027
  8. Avatar for Beany 88. Beany Lv 1 2 pts. 10,018
  9. Avatar for ShadowTactics 89. ShadowTactics Lv 1 2 pts. 10,014
  10. Avatar for alcor29 90. alcor29 Lv 1 2 pts. 10,013

Comments