Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for ichwilldiesennamen
    1. ichwilldiesennamen Lv 1
    100 pts. 11,100
  2. Avatar for Formula350 2. Formula350 Lv 1 97 pts. 11,047
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 11,032
  4. Avatar for MicElephant 4. MicElephant Lv 1 90 pts. 11,024
  5. Avatar for mirp 5. mirp Lv 1 87 pts. 11,010
  6. Avatar for Xartos 6. Xartos Lv 1 84 pts. 11,001
  7. Avatar for Deleted player 7. Deleted player pts. 10,982
  8. Avatar for Aubade01 8. Aubade01 Lv 1 78 pts. 10,980
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 75 pts. 10,950
  10. Avatar for grogar7 10. grogar7 Lv 1 73 pts. 10,924

Comments