Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 11,108
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 83 pts. 11,107
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 69 pts. 11,107
  4. Avatar for Xartos 4. Xartos Lv 1 56 pts. 11,107
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 45 pts. 11,101
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 36 pts. 11,100
  7. Avatar for silent gene 7. silent gene Lv 1 29 pts. 11,078
  8. Avatar for fuxinyu 8. fuxinyu Lv 1 23 pts. 11,046
  9. Avatar for HuubR 9. HuubR Lv 1 18 pts. 11,031
  10. Avatar for LociOiling 10. LociOiling Lv 1 14 pts. 11,031

Comments