Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 11,108
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 83 pts. 11,107
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 69 pts. 11,107
  4. Avatar for Xartos 4. Xartos Lv 1 56 pts. 11,107
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 45 pts. 11,101
  6. Avatar for Anfinsen_slept_here 6. Anfinsen_slept_here Lv 1 36 pts. 11,100
  7. Avatar for silent gene 7. silent gene Lv 1 29 pts. 11,078
  8. Avatar for fuxinyu 8. fuxinyu Lv 1 23 pts. 11,046
  9. Avatar for HuubR 9. HuubR Lv 1 18 pts. 11,031
  10. Avatar for LociOiling 10. LociOiling Lv 1 14 pts. 11,031

Comments