Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262
  1. Avatar for MicElephant 11. MicElephant Lv 1 10 pts. 11,025
  2. Avatar for Jpilkington 12. Jpilkington Lv 1 8 pts. 11,006
  3. Avatar for Keresto 13. Keresto Lv 1 6 pts. 10,998
  4. Avatar for Galaxie 14. Galaxie Lv 1 4 pts. 10,988
  5. Avatar for Mike Lewis 15. Mike Lewis Lv 1 3 pts. 10,987
  6. Avatar for OWM3 16. OWM3 Lv 1 2 pts. 10,986
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 2 pts. 10,950
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 10,935
  9. Avatar for CharlieFortsConscience 19. CharlieFortsConscience Lv 1 1 pt. 10,935
  10. Avatar for MrZanav 20. MrZanav Lv 1 1 pt. 10,928

Comments