Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups


  1. Avatar for Go Science 100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262

  1. Avatar for kludbrook 101. kludbrook Lv 1 1 pt. 8,728
  2. Avatar for drumpeter18yrs9yrs 102. drumpeter18yrs9yrs Lv 1 1 pt. 8,714
  3. Avatar for zannipietro 103. zannipietro Lv 1 1 pt. 8,703
  4. Avatar for cjddig 104. cjddig Lv 1 1 pt. 8,669
  5. Avatar for Tifdaff 105. Tifdaff Lv 1 1 pt. 8,662
  6. Avatar for WolverineX 106. WolverineX Lv 1 1 pt. 8,634
  7. Avatar for Beany 108. Beany Lv 1 1 pt. 8,614
  8. Avatar for HuubR 109. HuubR Lv 1 1 pt. 8,610
  9. Avatar for Mohoernchen 110. Mohoernchen Lv 1 1 pt. 8,581

Comments