1887: Refinement Target: R1091
Closed since over 5 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- September 04, 2020
- Expires
- Max points
- 100
CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL