Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,213
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 8,081
  3. Avatar for Team Canada 13. Team Canada 1 pt. 7,876
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,576
  5. Avatar for CH4110 Fold it! 15. CH4110 Fold it! 1 pt. 7,354
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 7,055
  7. Avatar for Window Group 17. Window Group 1 pt. 5,755
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,091
  1. Avatar for Visok 91. Visok Lv 1 2 pts. 8,139
  2. Avatar for AlkiP0Ps 92. AlkiP0Ps Lv 1 2 pts. 8,114
  3. Avatar for jsfoldingaccount 93. jsfoldingaccount Lv 1 2 pts. 8,104
  4. Avatar for fpc 94. fpc Lv 1 1 pt. 8,081
  5. Avatar for Javasharp 95. Javasharp Lv 1 1 pt. 8,075
  6. Avatar for borattt 96. borattt Lv 1 1 pt. 8,071
  7. Avatar for Capacocha 97. Capacocha Lv 1 1 pt. 8,022
  8. Avatar for rabamino12358 98. rabamino12358 Lv 1 1 pt. 7,992
  9. Avatar for Auntecedent 99. Auntecedent Lv 1 1 pt. 7,989
  10. Avatar for xbp 100. xbp Lv 1 1 pt. 7,914

Comments

spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?