Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,213
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 8,081
  3. Avatar for Team Canada 13. Team Canada 1 pt. 7,876
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,576
  5. Avatar for CH4110 Fold it! 15. CH4110 Fold it! 1 pt. 7,354
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 7,055
  7. Avatar for Window Group 17. Window Group 1 pt. 5,755
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,091

  1. Avatar for NStoner12 151. NStoner12 Lv 1 1 pt. 5,091
  2. Avatar for ncurrao 152. ncurrao Lv 1 1 pt. 5,091
  3. Avatar for b18bart 153. b18bart Lv 1 1 pt. 5,091
  4. Avatar for spvincent 154. spvincent Lv 1 1 pt. 5,091

Comments


spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?