1890: Revisiting Puzzle 136: Cell Adhesion
Closed since over 5 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- September 11, 2020
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Top groups
-
1. Go Science100 pts. 9,958
-
-
-
-
-
-
-
-
-
Comments
spmm Lv 1
This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .
bkoep Staff Lv 1
Segment 25 should not be locked. Can you give some more details about the issue?
Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?