Placeholder image of a protein
Icon representing a puzzle

1911: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
October 29, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,784
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,749
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 10,099
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,998
  5. Avatar for Window Group 15. Window Group 1 pt. 8,975

  1. Avatar for Rezondor 111. Rezondor Lv 1 1 pt. 10,229
  2. Avatar for Tac1 112. Tac1 Lv 1 1 pt. 10,204
  3. Avatar for LtKowalski 113. LtKowalski Lv 1 1 pt. 10,199
  4. Avatar for AlkiP0Ps 114. AlkiP0Ps Lv 1 1 pt. 10,194
  5. Avatar for mbeeg 115. mbeeg Lv 1 1 pt. 10,186
  6. Avatar for Francisco711 116. Francisco711 Lv 1 1 pt. 10,185
  7. Avatar for Jenot96 117. Jenot96 Lv 1 1 pt. 10,174
  8. Avatar for Nebulous_ 118. Nebulous_ Lv 1 1 pt. 10,163
  9. Avatar for Gamercat01 119. Gamercat01 Lv 1 1 pt. 10,160
  10. Avatar for Der_Seb 120. Der_Seb Lv 1 1 pt. 10,157

Comments


APPAAP Lv 1

psipred

MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

1
CCHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCC
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEY

51
CHHHHHHHHHHHCCCCCCEEEECCEEECCHHHHHHHHHCCCHHHHHHHCC
GNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCY

101
C
L

Who knows what this regulate oxidation in the cell means?

APPAAP Lv 1

There is more to it in order to get extra bonus you need to form the 2C (Cysteine) bonds in the 2Fe-2C.
This is hard to be achieved manually and now it comes to the importance of recipes.
You all can download Bridge Wiggle v 1.2.1 - Brow42 recipe from foldit recipes ID 37416 or
you can go to the recipe pages in https://fold.it/portal/recipe/37416 and read the information provided.
There exist a nice explanation by foldit user JeniferRM.
One thing I noticed with recipes is that one learns to use the recipe for the specific job.
More to this is to understand the script which is a little bit of programming in lua with foldit functions.
The reason that I do not mostly use recipes is that one has to understand first.
Personally I prefer to work alone but also have in the back of my mind the powerfull techniques of groups and recipes
in automation and time saving.
Good luck to anyone with this puzzle but I do not have the time to get involved online, may I will check it in my rest time in stand alone mode. I mostly concerned about SARS CoV-2.

Formula350 Lv 1

You can do it the easy way by banding from CYS tip to CYS tip, type in for Length: 1.95 and Strength: 10.0 (that's Ten point Zero).

If they are already close enough, simply Wiggle Sidechains to create the bond.
If they are close, but just outside the range of WiggleSC, then you can either:
—-Grab ("Pull" with mouse) the structure that one of the CYS is on and gently move it a tiny it. The Band should take care of the rest.
—-Perform a "Local Wiggle" on one of the structures a CYS is on. The band will take care of the rest.
After they've made their Disulfide Bond, disable the band. IF there are minor clashes, do a WiggleSC first. Then do a Global Wiggle.

Easy peasy, lemon squeezy!

I used Brow's recipe originally, but found that most of the time it would end up causing the protein to bounce around and break the CYS bonds. where I'd end up having to do the above anyways (or CTRL+Z to get back the bands it made, then do the rest manually) just to re-forge their bonds.