Placeholder image of a protein
Icon representing a puzzle

1911: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
October 29, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,582
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,549
  3. Avatar for Go Science 3. Go Science 47 pts. 11,536
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,478
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 11,465
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 11,337
  7. Avatar for Contenders 7. Contenders 7 pts. 11,255
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 10,890
  9. Avatar for Team China 9. Team China 2 pts. 10,857
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,810

  1. Avatar for User098123 101. User098123 Lv 1 1 pt. 10,333
  2. Avatar for D_Bilidity 102. D_Bilidity Lv 1 1 pt. 10,325
  3. Avatar for pfirth 103. pfirth Lv 1 1 pt. 10,315
  4. Avatar for cbwest 104. cbwest Lv 1 1 pt. 10,314
  5. Avatar for xythus 105. xythus Lv 1 1 pt. 10,312
  6. Avatar for Beany 106. Beany Lv 1 1 pt. 10,301
  7. Avatar for Mohoernchen 107. Mohoernchen Lv 1 1 pt. 10,286
  8. Avatar for pascal ochem 108. pascal ochem Lv 1 1 pt. 10,268
  9. Avatar for Bucsan 109. Bucsan Lv 1 1 pt. 10,263
  10. Avatar for crpainter 110. crpainter Lv 1 1 pt. 10,234

Comments


APPAAP Lv 1

psipred

MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

1
CCHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCC
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEY

51
CHHHHHHHHHHHCCCCCCEEEECCEEECCHHHHHHHHHCCCHHHHHHHCC
GNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCY

101
C
L

Who knows what this regulate oxidation in the cell means?

APPAAP Lv 1

There is more to it in order to get extra bonus you need to form the 2C (Cysteine) bonds in the 2Fe-2C.
This is hard to be achieved manually and now it comes to the importance of recipes.
You all can download Bridge Wiggle v 1.2.1 - Brow42 recipe from foldit recipes ID 37416 or
you can go to the recipe pages in https://fold.it/portal/recipe/37416 and read the information provided.
There exist a nice explanation by foldit user JeniferRM.
One thing I noticed with recipes is that one learns to use the recipe for the specific job.
More to this is to understand the script which is a little bit of programming in lua with foldit functions.
The reason that I do not mostly use recipes is that one has to understand first.
Personally I prefer to work alone but also have in the back of my mind the powerfull techniques of groups and recipes
in automation and time saving.
Good luck to anyone with this puzzle but I do not have the time to get involved online, may I will check it in my rest time in stand alone mode. I mostly concerned about SARS CoV-2.

Formula350 Lv 1

You can do it the easy way by banding from CYS tip to CYS tip, type in for Length: 1.95 and Strength: 10.0 (that's Ten point Zero).

If they are already close enough, simply Wiggle Sidechains to create the bond.
If they are close, but just outside the range of WiggleSC, then you can either:
—-Grab ("Pull" with mouse) the structure that one of the CYS is on and gently move it a tiny it. The Band should take care of the rest.
—-Perform a "Local Wiggle" on one of the structures a CYS is on. The band will take care of the rest.
After they've made their Disulfide Bond, disable the band. IF there are minor clashes, do a WiggleSC first. Then do a Global Wiggle.

Easy peasy, lemon squeezy!

I used Brow's recipe originally, but found that most of the time it would end up causing the protein to bounce around and break the CYS bonds. where I'd end up having to do the above anyways (or CTRL+Z to get back the bands it made, then do the rest manually) just to re-forge their bonds.