Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965

  1. Avatar for Dhalion 91. Dhalion Lv 1 2 pts. 10,543
  2. Avatar for JasperD 92. JasperD Lv 1 2 pts. 10,542
  3. Avatar for fearjuan 93. fearjuan Lv 1 2 pts. 10,463
  4. Avatar for spdenne 94. spdenne Lv 1 2 pts. 10,459
  5. Avatar for fisherlr777 95. fisherlr777 Lv 1 2 pts. 10,435
  6. Avatar for abiogenesis 96. abiogenesis Lv 1 2 pts. 10,412
  7. Avatar for mwm64 97. mwm64 Lv 1 2 pts. 10,401
  8. Avatar for roman madala 98. roman madala Lv 1 1 pt. 10,388
  9. Avatar for hada 99. hada Lv 1 1 pt. 10,329
  10. Avatar for HMK 100. HMK Lv 1 1 pt. 10,316

Comments