Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for Blipperman 101. Blipperman Lv 1 1 pt. 10,307
  2. Avatar for Arne Heessels 102. Arne Heessels Lv 1 1 pt. 10,270
  3. Avatar for SHK5P 103. SHK5P Lv 1 1 pt. 10,250
  4. Avatar for zo3xiaJonWeinberg 104. zo3xiaJonWeinberg Lv 1 1 pt. 10,248
  5. Avatar for alyssa_d_V2.0 105. alyssa_d_V2.0 Lv 1 1 pt. 10,211
  6. Avatar for Yupa 106. Yupa Lv 1 1 pt. 10,209
  7. Avatar for Mike Cassidy 107. Mike Cassidy Lv 1 1 pt. 10,204
  8. Avatar for chris69300 108. chris69300 Lv 1 1 pt. 10,199
  9. Avatar for Jumper2 109. Jumper2 Lv 1 1 pt. 10,187
  10. Avatar for Beany 110. Beany Lv 1 1 pt. 10,155

Comments