Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for Dr.Sillem 111. Dr.Sillem Lv 1 1 pt. 10,116
  2. Avatar for davidoskky 112. davidoskky Lv 1 1 pt. 10,110
  3. Avatar for pascal ochem 113. pascal ochem Lv 1 1 pt. 10,085
  4. Avatar for Mohoernchen 114. Mohoernchen Lv 1 1 pt. 10,078
  5. Avatar for froschi2 115. froschi2 Lv 1 1 pt. 10,062
  6. Avatar for rinze 116. rinze Lv 1 1 pt. 10,033
  7. Avatar for cassandraL 117. cassandraL Lv 1 1 pt. 9,987
  8. Avatar for m.a.g.e 118. m.a.g.e Lv 1 1 pt. 9,958
  9. Avatar for ivalnic 119. ivalnic Lv 1 1 pt. 9,955
  10. Avatar for Zhiyuan Wang 120. Zhiyuan Wang Lv 1 1 pt. 9,946

Comments