Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for CH3F1-Magiera 131. CH3F1-Magiera Lv 1 1 pt. 9,795
  2. Avatar for reich64 132. reich64 Lv 1 1 pt. 9,783
  3. Avatar for llt1234563 133. llt1234563 Lv 1 1 pt. 9,782
  4. Avatar for fabiodavilla 134. fabiodavilla Lv 1 1 pt. 9,778
  5. Avatar for LtKowalski 135. LtKowalski Lv 1 1 pt. 9,774
  6. Avatar for snowleopard94 136. snowleopard94 Lv 1 1 pt. 9,773
  7. Avatar for illex 137. illex Lv 1 1 pt. 9,772
  8. Avatar for Jenot96 138. Jenot96 Lv 1 1 pt. 9,734
  9. Avatar for Cicadashell 139. Cicadashell Lv 1 1 pt. 9,706
  10. Avatar for mygames.cris 140. mygames.cris Lv 1 1 pt. 9,635

Comments