Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for Sydefecks 141. Sydefecks Lv 1 1 pt. 9,504
  2. Avatar for Auntecedent 142. Auntecedent Lv 1 1 pt. 9,411
  3. Avatar for folditusername14 143. folditusername14 Lv 1 1 pt. 9,275
  4. Avatar for tutianshuo 144. tutianshuo Lv 1 1 pt. 9,201
  5. Avatar for erasmus.wu.hui 145. erasmus.wu.hui Lv 1 1 pt. 9,188
  6. Avatar for shogi 146. shogi Lv 1 1 pt. 9,176
  7. Avatar for 01010011111 147. 01010011111 Lv 1 1 pt. 9,174
  8. Avatar for 0r3rv1ew 148. 0r3rv1ew Lv 1 1 pt. 9,170
  9. Avatar for RAN0043 149. RAN0043 Lv 1 1 pt. 9,029
  10. Avatar for rmoretti 150. rmoretti Lv 1 1 pt. 8,991

Comments