Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 73 pts. 11,682
  2. Avatar for jobo0502 12. jobo0502 Lv 1 71 pts. 11,673
  3. Avatar for grogar7 13. grogar7 Lv 1 68 pts. 11,667
  4. Avatar for nicobul 14. nicobul Lv 1 66 pts. 11,665
  5. Avatar for aznarog 15. aznarog Lv 1 64 pts. 11,657
  6. Avatar for Galaxie 16. Galaxie Lv 1 62 pts. 11,633
  7. Avatar for silent gene 17. silent gene Lv 1 60 pts. 11,631
  8. Avatar for johnmitch 18. johnmitch Lv 1 58 pts. 11,626
  9. Avatar for Aubade01 19. Aubade01 Lv 1 56 pts. 11,615
  10. Avatar for g_b 20. g_b Lv 1 54 pts. 11,611

Comments